PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT11380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ARR-B
Protein Properties Length: 651aa    MW: 71470.8 Da    PI: 6.8993
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT11380genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.61.4e-28215268155
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+ Lt+e+v+SHLQkYRl
  EMT11380 215 KPRVVWSAELHRKFVAAVNQL-GIDKAVPKRILELMNVEKLTRENVASHLQKYRL 268
               79*******************.********************************8 PP

2Response_reg653.5e-22251411109
                   EEEESSSHHHHHHHHHHHHHTTC.......EEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
  Response_reg   1 vlivdDeplvrellrqalekegy.......eevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                   vl vdD+p+ +++l+++l++ +y        + +++ ++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +ge + +l+
      EMT11380  25 VLAVDDDPVCLKVLEVLLRRCQYhgqsllaLHLTTTNQAATALRLLRENKdmFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGETKSVLK 120
                   799****************55543323333477899999999999998889********************87754.558***************** PP

                   HHHTTESEEEESS--HHHHHH CS
  Response_reg  89 alkaGakdflsKpfdpeelvk 109
                    +  Ga d+l Kp+ +eel++
      EMT11380 121 GITHGACDYLLKPVRIEELRN 141
                   *******************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.9E-1661609IPR017053Response regulator B-type, plant
SuperFamilySSF521721.08E-3022157IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.0E-3722183No hitNo description
SMARTSM004484.1E-2623143IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011038.92424147IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.0E-1925141IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.48E-2426146No hitNo description
Gene3DG3DSA:1.10.10.601.7E-30212273IPR009057Homeodomain-like
PROSITE profilePS5129411.182212271IPR017930Myb domain
SuperFamilySSF466895.73E-20213272IPR009057Homeodomain-like
TIGRFAMsTIGR015578.7E-26215268IPR006447Myb domain, plants
PfamPF002495.1E-7217267IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MMMEARKGLM ERERERDQFP VGMRVLAVDD DPVCLKVLEV LLRRCQYHGQ SLLALHLTTT  60
NQAATALRLL RENKDMFDLV ISDVHMPDMD GFKLLELVGL EMDLPVIMLS VNGETKSVLK  120
GITHGACDYL LKPVRIEELR NVWQHVVRRK FSNREPNNLD FCKEISKDSY HRLGQATCDR  180
SSDQSNRASK KRKELHSEEE DEGEDNDDAS AASKKPRVVW SAELHRKFVA AVNQLGIDKA  240
VPKRILELMN VEKLTRENVA SHLQKYRLYL RRLSAVASQQ ASIAAAFGGR DPFEGLHSYH  300
QPFAPSLNPH GLLSGAGAAT FELQDFVPSK AIQCASSIGA VSHCAGDTNK FNIVSLQDNQ  360
QADLTQGLTT SSLGQPRLQQ TWIHQETNDL CSVFSGGAQA NTMSGTFQRI TSSSLAPEDL  420
LECTPHIKLG AHPSIGISQQ GALPISDGFS VDKLPLHIPF DGADTGFLAR EPKMDQKGIF  480
SERMNVRVCP SESLIAANNA KCGASSSGST MLLPPDTERH SEYLQFGAAS NSRHRMDGVR  540
EDQCLNNADF SYDGGAIVPE QTHMDDLGIP KLQGGFNSSS CNFDGLLNSI IKVKNKNEAK  600
GLFGVSPLQN STSGAGVASA ENKGAGKHPL RRSSYFLEPS DYRTGPKCHM G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-24212274264ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3699660.0AK369966.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2102E11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564200.10.0PREDICTED: two-component response regulator ORR22
SwissprotB8B3I40.0ORR22_ORYSI; Two-component response regulator ORR22
TrEMBLM8BCJ10.0M8BCJ1_AEGTA; Two-component response regulator ARR12
STRINGMLOC_61880.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18563894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-101response regulator 12